December 21, 2024, 08:16:30 PM
Forum Rules: Read This Before Posting


Topic: Procedure for Labeling Peptide with radioisotope?  (Read 7001 times)

0 Members and 1 Guest are viewing this topic.

Offline TAISM2000

  • New Member
  • **
  • Posts: 3
  • Mole Snacks: +0/-0
Procedure for Labeling Peptide with radioisotope?
« on: August 09, 2009, 08:17:03 PM »
What is the suggested procedure to label any peptide with radioisotope

Offline gippgig

  • Full Member
  • ****
  • Posts: 139
  • Mole Snacks: +8/-2
Re: Procedure for Labeling Peptide with radioisotope?
« Reply #1 on: August 10, 2009, 02:12:51 AM »
What kind of label?
Are you referring to synthesizing a labeled peptide? Labeling a naturally produced peptide in an organism? Labeling an existing peptide?

Offline TAISM2000

  • New Member
  • **
  • Posts: 3
  • Mole Snacks: +0/-0
Re: Procedure for Labeling Peptide with radioisotope?
« Reply #2 on: August 10, 2009, 02:51:00 AM »
Labeling an existing peptide.

Offline gippgig

  • Full Member
  • ****
  • Posts: 139
  • Mole Snacks: +8/-2
Re: Procedure for Labeling Peptide with radioisotope?
« Reply #3 on: August 10, 2009, 10:44:20 PM »
The simplest thing is to react the peptide with a labeled compound that will covalently bond to it. For example, if you have labeled acetate, you could acetylate the N-terminus (assuming it isn't blocked) the same way (taking whatever radiation handling precautions are warranted) you would acetylate it with unlabeled acetate. Of course, this would change both the chemical & biological properties of the peptide.

Offline TAISM2000

  • New Member
  • **
  • Posts: 3
  • Mole Snacks: +0/-0
Re: Procedure for Labeling Peptide with radioisotope?
« Reply #4 on: August 17, 2009, 08:05:22 PM »
Thank you for this clarification.

I am trying to label Leptin with Indium - 111.

Lipten =  MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPIL
TLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGY
STEVVALSRLQGSLQDMLWQLDLSPGC

Any particular protocol/method.

Thank you for your help

Sponsored Links